| Desktop | 0/100 | ✘ |
| Mobile | 0/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 0 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 60 / 490 (bytes) = 12.24% | ✔ |
| Load Time | 0.53 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 0 | ✔ |
| Doc Type | NA | ❗ |
| Encoding | NA | ✘ |
| Declared Language | Unknown | ✘ |
| Preferred Domain | No | ❗ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 0 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|
|
With 0.53 seconds in page load, 0 KB of page size and all other reports below, the caraccidentlawyerpinellaspark.com has a SEO score of 51 out of 100 |
| Title | Car Accident Lawyer Pinellas Park - Auto Accident Attorney |
| Description | Car Accident Lawyer in Pinellas Park. McQuaid & Douglas are rated Best Auto Accident Attorneys in FL. Free Consultation No Fee until we Win Call 727-490-1212 |
| Keyword |
| Age | 0 Years, 4 Days |
| Created | 21st-Aug-2020 |
| Updated | 21st-Aug-2020 |
| Expiry | 21st-Aug-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| caraccidentlawyerpinellaspark.com | A | 587 | ip:35.206.122.11 |
| caraccidentlawyerpinellaspark.com | NS | 3600 | target:ns12.domaincontrol.com |
| caraccidentlawyerpinellaspark.com | NS | 3600 | target:ns11.domaincontrol.com |
| caraccidentlawyerpinellaspark.com | SOA | 3600 | mname:ns11.domaincontrol.comrname:dns.jomax.netserial:2020082101refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: caraccidentlawyerpinellaspark.com Registry Domain ID: 2554581985_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-08-21T12:43:26Z Creation Date: 2020-08-21T12:43:25Z Registrar Registration Expiration Date: 2021-08-21T12:43:25Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Registrant State/Province: Florida Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=caraccidentlawyerpinellaspark.com Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=caraccidentlawyerpinellaspark.com Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=caraccidentlawyerpinellaspark.com Name Server: NS11.DOMAINCONTROL.COM Name Server: NS12.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-08-25T08:00:00Z |
| Server IP | 35.206.122.11 |
| Server Location | United States |
| Service Provider | Google Cloud |
| Domains (TLD) | Status |
|---|---|
| caraccidentlawyerpinellaspark.net | Available |
| caraccidentlawyerpinellaspark.org | Already Registered |
| caraccidentlawyerpinellaspark.biz | Already Registered |
| caraccidentlawyerpinellaspark.io | Already Registered |
| caraccidentlawyerpinellaspark.info | Available |
| Domains (TLD) | Status |
|---|---|
| caracidentlawyerpinelaspark.com | Available |
| xaraccidentlawyerpinellaspark.com | Available |
| saraccidentlawyerpinellaspark.com | Available |
| daraccidentlawyerpinellaspark.com | Available |
| faraccidentlawyerpinellaspark.com | Available |
| Vic3nt.com |
| The-edge-of-chaos.com |
| Donleobotilleria.com |
| Soyluyapi.com |
| Bascourt.com |
| Ayo-calendar0016.com |
| Zuocitrading.com |
| Heartandwoodco.com |
| Comprafansymas.com |
| Growingupcoug.com |